PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.1G447300.1.p
Common NamePRUPE_ppa015753mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GATA
Protein Properties Length: 385aa    MW: 42241.6 Da    PI: 6.7278
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.1G447300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.95.7e-18265299135
                GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                         C +C t kTp+WR gp g+ktLCnaCG++y++ +l
  Prupe.1G447300.1.p 265 CLHCATDKTPQWRTGPLGPKTLCNACGVRYKSGRL 299
                         99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004012.0E-15259309IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.242259295IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.104.9E-14261297IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577162.66E-15261323No hitNo description
CDDcd002021.71E-14264311No hitNo description
PfamPF003208.1E-16265299IPR000679Zinc finger, GATA-type
PROSITE patternPS003440265290IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MEAPEYFQNS FCPQFTPEKR HSFDNNNNKA TNGGGGGGDH FMVEDLLDFS NDDAVITDGG  60
ATFDNATGNS TDSSTITVID SCNSSSLSGS EPNVIPDIGS RNITEGPFSS DLCVPYDDLA  120
ELEWLSNFVE ESFSSEDMQK LQLISGMKAR PDEAASETRQ FQPEPNRNDN AHNTTTNNPI  180
FNPDVSVPAK ARSKRSRGAP CNWTSRLLLL SQPTSSSEQS DVVSGAPESP LPPPSTTGKK  240
TVKSVPKKKE SPEGLGGGPG DGRKCLHCAT DKTPQWRTGP LGPKTLCNAC GVRYKSGRLV  300
PEYRPASSPT FVLTKHSNSH RKVLELRRQK EMVRAQQQFI HQVPPQQHHH HHHHHHHQNM  360
VFDVSNGGDY LIHQHMGPDF RQLI*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00530DAPTransfer from AT5G25830Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007226931.10.0hypothetical protein PRUPE_ppa015753mg
SwissprotP697812e-91GAT12_ARATH; GATA transcription factor 12
TrEMBLM5Y8040.0M5Y804_PRUPE; Uncharacterized protein
STRINGVIT_04s0008g03270.t011e-163(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13643395
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25830.14e-89GATA transcription factor 12